Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

Velibah Patatesli Gözleme Tarifi – Börek Tarifleri
Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

Velibah Patatesli Gözleme Tarifi – Börek Tarifleri
Yöresel videolu yemek tariflerinefispratikyemektarifleri.comun bölümünde yer alıyor. Siz dekolay yemek tariflerisayfalarımızı sosyal medyada paylaşabilirsiniz.

2 su bardağı ılık su
1 pake kuru maya
1 çorba kaşığı şeker
1 tatlı kaşığı tuz
6 su bardağı un
10 ade haşlanmış patates
Pul biber
1 adet soğan

Mayamızı ve şekeri ılık suda karıştırıp 5 dakika bekleterek eritiyoruz. Unumuzu bir kaba koyuyoruz ve yuzumuzu atıyoruz. köpüren mayamızı da iç,ne döküyoruz. 1,5 su bardağı ılık su koyuyoruz.Yavaş yavaş yoğuruyoruz. Ele yapışmayacak bir hamur elde ediyoruz. Yarım saat kadar mayalanmaya bırakıyoruz.
bir yandan soğanı yemeklik olarak doğrayıp sıvıyağda kavuruyoruz. Haşlanmış patateslerimizi soyuyoruz ve eziyoruz. Baharatlarımızı ekliyoruz. kavrulmuş soğanı da ilave ediyoruz. Mayalanan hamurumuzdan bezeler koparıp oklava yardımıyla pişireceğimiz tavaya göre büyüklükte açıyoruz. İçine top yaptığımız patates harçlarımızdan birini koyuyoruz ve hamuru yuvarlak yapıyoruz. Daha sonra yuvarlak yaptığımız hamurları tekrar oklava yardımıyla açarak pişiriyoruz.

Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

Related news

  • Apple Randevu alamıyorum diyenlere zorlu ve akasya’dan randevu nasıl alınır
  • Fazla Protein Alımı ve Zararları
  • Reem Acra Sonbahar 2019 Gelinlik Modelleri
  • Fırında Tavuk Kanat Tarifi Videosu
  • Trend Uyarısı: Tel Toka İle Saç Modelleri

  • Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri

    Velibah Patatesli Gözleme Tarifi – Börek Tarifleri